PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.VAD3A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB
Protein Properties Length: 294aa    MW: 33406.2 Da    PI: 6.2776
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.VAD3AgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.32.3e-101454148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l +++ ++G g+W++        R++k+c++rw +yl
      Araip.VAD3A 14 KGLWSPEEDEKLFNYISRFGVGCWRL-------QRCGKSCRLRWINYL 54
                     678***********************.......7999*********97 PP

2Myb_DNA-binding46.11.1e-1460104147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg ++++E++l++ +++ lG++ W+ Ia+ ++ gRt++++k++w++ 
      Araip.VAD3A  60 RGMFSQQEEDLIITLHEVLGNR-WAQIAAQLP-GRTDNEIKNFWNSC 104
                      788*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.5E-18657IPR009057Homeodomain-like
PROSITE profilePS5129412.56954IPR017930Myb domain
SuperFamilySSF466894.49E-2512101IPR009057Homeodomain-like
SMARTSM007174.9E-71356IPR001005SANT/Myb domain
PfamPF002491.2E-91454IPR001005SANT/Myb domain
CDDcd001674.54E-81754No hitNo description
PROSITE profilePS5129424.23255109IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2558109IPR009057Homeodomain-like
SMARTSM007172.0E-1359107IPR001005SANT/Myb domain
PfamPF002491.1E-1360104IPR001005SANT/Myb domain
CDDcd001671.81E-963102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MGRHSCCLKQ KLRKGLWSPE EDEKLFNYIS RFGVGCWRLQ RCGKSCRLRW INYLRPDLKR  60
GMFSQQEEDL IITLHEVLGN RWAQIAAQLP GRTDNEIKNF WNSCLKKKLM KQGIDPTTHK  120
PLHNHEDKDN DTIINNNNNN NTTQAACSSS SSMAMLDGII GGVSSSLSSS SLLLDPLTCL  180
DFSHHHENYG LLFSSMPSLD MNNNNNNNAL LSSTSSWDCC SNEEENKLES LFQFHHQLKS  240
EEEFNTNYNN NVQQNSMQED FMSSYNNLRS LSSEDLSAAA AAVAGPNFDV FHQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121095108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0956766e-72BT095676.1 Soybean clone JCVI-FLGm-19P23 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016193203.10.0PREDICTED: transcription factor MYB86-like
TrEMBLA0A072UQ148e-90A0A072UQ14_MEDTR; Myb transcription factor
STRINGGLYMA05G02550.24e-88(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.11e-72myb domain protein 86